Loading...
Statistics
Advertisement

Top Architects and Interior Designers in Mumbai & Thane
www.kunalbarve.com/
Designing your homes that expresses feelings is our motto. Kunal Barve is among the top architect and interior designers in Mumbai.

Kunalbarve.com

Advertisement
Conversion Technology Metas Server
Kunalbarve.com is hosted in India . Kunalbarve.com uses HTTPS protocol. Number of used technologies: 6. First technologies: CSS, Font Awesome, Html, Number of used javascripts: 7. First javascripts: Jquery.min.js, Js-image-slider.js, Index.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: Microsoft-IIS/7.5.

Technologies in use by Kunalbarve.com

Technology

Number of occurences: 6
  • CSS
  • Font Awesome
  • Html
  • Html5
  • Javascript
  • jQuery

Advertisement

Javascripts

Number of occurences: 7
  • jquery.min.js
  • js-image-slider.js
  • index.js
  • classie.js
  • borderMenu.js
  • jquery-2.1.1.js
  • jpreloader.js

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Microsoft-IIS/7.5

Powered by

  • ASP.NET

CDN

Number of occurences: 2
  • BootstrapCDN
  • Maxcdn

Google Analytics ID

  • UA-63090672-1

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Kunalbarve.com

SSL certificate

    • name: /OU=Domain Control Validated/OU=PositiveSSL/CN=appstudio.co.in
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: PositiveSSL
      • CN: appstudio.co.in
    • hash: bc2f8c61
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 152735153281332449103073491125414169429
    • validFrom: 160308000000Z
    • validTo: 170308235959Z
    • validFrom_time_t: 1457395200
    • validTo_time_t: 1489017599
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: A0:DB:F9:EA:7B:1B:49:B1:E5:71:45:B4:3B:9B:20:78:A6:C1:96:40
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:appstudio.co.in, DNS:www.appstudio.co.in

Meta - Kunalbarve.com

Number of occurences: 13
  • Name: description
    Content: Designing your homes that expresses feelings is our motto. Kunal Barve is among the top architect and interior designers in Mumbai.
  • Name: google-site-verification
    Content: AUaEVYIIjeGzCA22vLNnYuUv8PTxjG3fPicVodsNeJk
  • Name: keywords
    Content: top architects and interior designers in Mumbai, top interior designers in Mumbai
  • Name: classification
    Content: Architect & Interior Designer in Mumbai
  • Name: audience
    Content: all
  • Name: author
    Content: Interface – Architect by Kunal Barve
  • Name: revisit-after
    Content: 4 days
  • Name: content-Language
    Content: English
  • Name: distribution
    Content: global
  • Name: copyright
    Content: by http://kunalbarve.com/
  • Name: robots
    Content: All
  • Name:
    Content: text/html; charset=UTF-8
  • Name: viewport
    Content: width=device-width, user-scalable=no, initial-scale=1.0, minimum-scale=1.0, maximum-scale=1.0

Server / Hosting

  • IP: 103.241.180.253
  • Latitude: 20.00
  • Longitude: 77.00
  • Country: India

Rname

  • addya.mercury.orderbox-dns.com
  • addya.venus.orderbox-dns.com
  • addya.earth.orderbox-dns.com
  • addya.mars.orderbox-dns.com
  • us3.mx1.mailhostbox.com
  • us3.mx3.mailhostbox.com
  • us3.mx2.mailhostbox.com

Target

  • shantypath.gmail.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Content-Type: text/html; charset=UTF-8 Location: http://kunalbarve.com/ Server: Microsoft-IIS/7.5 X-Powered-By: ASP.NET X-Powered-By-Plesk: PleskWin Date: Wed, 31 Aug 2016 07:28:48 GMT Content-Length: 145 X-Cache: MISS from s_mf40 X-Cache-Lookup: MISS from s_mf40:80 Via: 1.1 s_mf40 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 OK Content-Type: text/html Last-Modified: Tue, 21 Jun 2016 05:19:11 GMT Accept-Ranges: bytes ETag: "52947b717ccbd11:0" Server: Microsoft-IIS/7.5 X-Powered-By: ASP.NET X-Powered-By-Plesk: PleskWin Date: Wed, 31 Aug 2016 07:28:48 GMT Content-Length: 23884 X-Cache: MISS from s_mf40 X-Cache-Lookup: MISS from s_mf40:80 Via: 1.1 s_mf40 (squid/3.5.20) Connection: keep-alive

DNS

host: kunalbarve.com
  1. class: IN
  2. ttl: 28800
  3. type: A
  4. ip: 103.241.180.253
host: kunalbarve.com
  1. class: IN
  2. ttl: 38400
  3. type: NS
  4. target: addya.mercury.orderbox-dns.com
host: kunalbarve.com
  1. class: IN
  2. ttl: 38400
  3. type: NS
  4. target: addya.venus.orderbox-dns.com
host: kunalbarve.com
  1. class: IN
  2. ttl: 38400
  3. type: NS
  4. target: addya.earth.orderbox-dns.com
host: kunalbarve.com
  1. class: IN
  2. ttl: 38400
  3. type: NS
  4. target: addya.mars.orderbox-dns.com
host: kunalbarve.com
  1. class: IN
  2. ttl: 7200
  3. type: SOA
  4. mname: addya.mercury.orderbox-dns.com
  5. rname: shantypath.gmail.com
  6. serial: 2016073101
  7. refresh: 7200
  8. retry: 7200
  9. expire: 172800
  10. minimum-ttl: 7200
host: kunalbarve.com
  1. class: IN
  2. ttl: 38400
  3. type: MX
  4. pri: 100
  5. target: us3.mx1.mailhostbox.com
host: kunalbarve.com
  1. class: IN
  2. ttl: 38400
  3. type: MX
  4. pri: 100
  5. target: us3.mx3.mailhostbox.com
host: kunalbarve.com
  1. class: IN
  2. ttl: 38400
  3. type: MX
  4. pri: 100
  5. target: us3.mx2.mailhostbox.com
host: kunalbarve.com
  1. class: IN
  2. ttl: 38400
  3. type: TXT
  4. txt: v=spf1 redirect=_spf.mailhostbox.com
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.unalbarve.com, www.ktunalbarve.com, www.tunalbarve.com, www.kunalbarve.com, www.unalbarve.com, www.kgunalbarve.com, www.gunalbarve.com, www.kbunalbarve.com, www.bunalbarve.com, www.knunalbarve.com, www.nunalbarve.com, www.khunalbarve.com, www.hunalbarve.com, www.kyunalbarve.com, www.yunalbarve.com, www.klunalbarve.com, www.lunalbarve.com, www.kounalbarve.com, www.ounalbarve.com, www.kuunalbarve.com, www.uunalbarve.com, www.kiunalbarve.com, www.iunalbarve.com, www.kmunalbarve.com, www.munalbarve.com, www.knalbarve.com, www.kuwnalbarve.com, www.kwnalbarve.com, www.kuenalbarve.com, www.kenalbarve.com, www.kusnalbarve.com, www.ksnalbarve.com, www.kuanalbarve.com, www.kanalbarve.com, www.kualbarve.com, www.kunnalbarve.com, www.kunalbarve.com, www.kunhalbarve.com, www.kuhalbarve.com, www.kunjalbarve.com, www.kujalbarve.com, www.kunkalbarve.com, www.kukalbarve.com, www.kunlalbarve.com, www.kulalbarve.com, www.kun albarve.com, www.ku albarve.com, www.kunlbarve.com, www.kunaolbarve.com, www.kunolbarve.com, www.kunaplbarve.com, www.kunplbarve.com, www.kuna9lbarve.com, www.kun9lbarve.com, www.kunalbarve.com, www.kunlbarve.com, www.kunailbarve.com, www.kunilbarve.com, www.kunaulbarve.com, www.kunulbarve.com, www.kunabarve.com, www.kunalubarve.com, www.kunaubarve.com, www.kunal8barve.com, www.kuna8barve.com, www.kunal9barve.com, www.kuna9barve.com, www.kunaljbarve.com, www.kunajbarve.com, www.kunal0barve.com, www.kuna0barve.com, www.kunalmbarve.com, www.kunambarve.com, www.kunalpbarve.com, www.kunapbarve.com, www.kunalobarve.com, www.kunaobarve.com, www.kunalarve.com, www.kunalbqarve.com, www.kunalqarve.com, www.kunalbwarve.com, www.kunalwarve.com, www.kunalbzarve.com, www.kunalzarve.com, www.kunalbxarve.com, www.kunalxarve.com, www.kunalbarve.com, www.kunalarve.com, www.kunalbsarve.com, www.kunalsarve.com, www.kunalbyarve.com, www.kunalyarve.com, www.kunalbearve.com, www.kunalearve.com, www.kunalbdarve.com, www.kunaldarve.com, www.kunalbcarve.com, www.kunalcarve.com, www.kunalbrve.com, www.kunalbaorve.com, www.kunalborve.com, www.kunalbaprve.com, www.kunalbprve.com, www.kunalba9rve.com, www.kunalb9rve.com, www.kunalbarve.com, www.kunalbrve.com, www.kunalbairve.com, www.kunalbirve.com, www.kunalbaurve.com, www.kunalburve.com, www.kunalbave.com, www.kunalbarive.com, www.kunalbaive.com, www.kunalbarove.com, www.kunalbaove.com, www.kunalbarlve.com, www.kunalbalve.com, www.kunalbarlve.com, www.kunalbalve.com, www.kunalbar.ve.com, www.kunalba.ve.com, www.kunalbare.com, www.kunalbarvye.com, www.kunalbarye.com, www.kunalbarvze.com, www.kunalbarze.com, www.kunalbarvhe.com, www.kunalbarhe.com, www.kunalbarvne.com, www.kunalbarne.com, www.kunalbarvme.com, www.kunalbarme.com, www.kunalbarvje.com, www.kunalbarje.com, www.kunalbarvke.com, www.kunalbarke.com, www.kunalbarvie.com, www.kunalbarie.com, www.kunalbarv.com, www.kunalbarvex.com, www.kunalbarvx.com, www.kunalbarves.com, www.kunalbarvs.com, www.kunalbarvew.com, www.kunalbarvw.com, www.kunalbarver.com, www.kunalbarvr.com, www.kunalbarvef.com, www.kunalbarvf.com, www.kunalbarvev.com, www.kunalbarvv.com, www.kunalbarvec.com, www.kunalbarvc.com, www.kunalbarveq.com, www.kunalbarvq.com, www.kunalbarvea.com, www.kunalbarva.com, www.kunalbarvey.com, www.kunalbarvy.com,

Other websites we recently analyzed

  1. acrylic-sheet.net
    Scottsdale (United States) - 50.63.202.52
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  2. Siel Bleu Home - Siel Bleu Ireland
    France - 213.186.33.82
    Server software: Apache
    Technology: BootstrapCDN, Maxcdn, Carousel, CSS, Datepicker, Flexslider, Font Awesome, Google Font API, Html, Html5, Iframe, Javascript, jQuery, jQuery Colorbox, jQuery Fancybox, jQuery Validate, Php, Pingback, Shortcodes, Wordpress
    Number of Javascript: 37
    Number of meta tags: 3
  3. وب سايت توانمندي
    Iran, Islamic Republic of - 5.144.130.33
    Server software: Apache
    Technology: CSS, Html, Html5, jQuery, Php, Pingback, Swf Object, Wordpress
    Number of Javascript: 4
    Number of meta tags: 2
  4. porshacjackson
    Ashburn (United States) - 54.83.179.144
    Server software: Pepyaka/1.9.13
    Technology: CSS, Html, Html5, Javascript, Wix
    Number of Javascript: 2
    Number of meta tags: 5
  5.  
    Ashburn (United States) - 52.0.217.44
    Server software:
    Technology: CSS, Google Font API, Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 2
  6. rostocker-fruehling – Initiative für Demokratie und Umweltschutz
    diese website ist grad in Überarbeitung ...   Rettet die Natur in den Wall-Anlagen vor den Umbauten! Liebe Freundinnen und Freunde des rostocker frühling, kommt alle zum Bürgerforum zum Thema Wallanlagen: die Planungen zur Dreiwallbastion und zur Heubastion werden vorgestellt und diskutiert: am Dienstag, 11. August 2015, um 17:00 Uhr, im Kulturhistorischen Museum, im Kapitelsaal.…
    San Francisco (United States) - 192.0.78.13
    Server software: Apache
    Technology: Skimlinks, CSS, Google Font API, Gravatar, Html, Html5, Javascript, Php, Pingback, comScore, Wordpress
    Number of Javascript: 6
    Number of meta tags: 12
  7. Get Money Empire Inc. - Home
    San Francisco (United States) - 199.34.228.68
    Server software: Apache
    Technology: CSS, Html, Html5, Iframe, Javascript, Php, SVG, Google Analytics, Quantcast Measurement, Webly
    Number of Javascript: 5
    Number of meta tags: 1
  8. vuki.science
    Austin (United States) - 209.99.40.219
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  9. Huron Valley Cabling and Consulting
    Business for Telephone and Computer Cabling
    Mountain View (United States) - 74.125.206.121
    Server software: ghs
    Technology: CSS, Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 3
  10. physiciansadvancedfitnessmedicine.com
    Provo (United States) - 198.57.247.164
    Server software: nginx/1.10.1
    Technology: Html
    Number of meta tags: 2

Check Other Websites